PDB entry 1vl9

View 1vl9 on RCSB PDB site
Description: atomic resolution (0.97a) structure of the triple mutant (k53,56,121m) of bovine pancreatic phospholipase a2
Deposited on 2004-07-15, released 2004-10-19
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-19, with a file datestamp of 2004-10-19.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: 0.114
AEROSPACI score: 1.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vl9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vl9A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    mnc