PDB entry 1vl9

View 1vl9 on RCSB PDB site
Description: Atomic resolution (0.97A) structure of the triple mutant (K53,56,121M) of bovine pancreatic phospholipase A2
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Triple mutant, Calcium ion, HYDROLASE
Deposited on 2004-07-15, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 0.97 Å
R-factor: N/A
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospholipase a2
    Species: Bos taurus [TaxId:9913]
    Gene: PLA2G1B
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00593 (0-122)
      • engineered (52)
      • engineered (55)
      • engineered (120)
    Domains in SCOPe 2.07: d1vl9a_
  • Heterogens: CA, CL, MRD, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vl9A (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldk
    mnc