PDB entry 1vl8

View 1vl8 on RCSB PDB site
Description: Crystal structure of Gluconate 5-dehydrogenase (TM0441) from Thermotoga maritima at 2.07 A resolution
Class: oxidoreductase
Keywords: TM0441, GLUCONATE 5-DEHYDROGENASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics
Deposited on 2004-07-14, released 2004-08-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.151
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gluconate 5-dehydrogenase
    Species: Thermotoga maritima MSB8
    Gene: TM0441
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vl8a_
  • Chain 'B':
    Compound: Gluconate 5-dehydrogenase
    Species: Thermotoga maritima MSB8
    Gene: TM0441
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1vl8b_
  • Heterogens: PO4, MG, NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl8A (A:)
    mgsdkihhhhhhmkevfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleease
    aaqkltekygvetmafrcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpl
    defrqvievnlfgtyyvcreafsllresdnpsiinigsltveevtmpnisayaaskggva
    sltkalakewgrygirvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkg
    vavflaseeakyvtgqiifvdggwtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl8A (A:)
    fdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleeaseaaqkltekygvetmaf
    rcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpldefrqvievnlfgtyy
    vcreafsllresdnpsiinigsltveevtmpnisayaaskggvasltkalakewgrygir
    vnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkgvavflaseeakyvtgq
    iifvdggwtan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl8B (B:)
    mgsdkihhhhhhmkevfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleease
    aaqkltekygvetmafrcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpl
    defrqvievnlfgtyyvcreafsllresdnpsiinigsltveevtmpnisayaaskggva
    sltkalakewgrygirvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkg
    vavflaseeakyvtgqiifvdggwtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl8B (B:)
    vfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleeaseaaqkltekygvetma
    frcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpldefrqvievnlfgty
    yvcreafsllresdnpsiinigsltveevtmpnisayaaskggvasltkalakewgrygi
    rvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkgvavflaseeakyvtg
    qiifvdggwtan