PDB entry 1vl8

View 1vl8 on RCSB PDB site
Description: Crystal structure of Gluconate 5-dehydrogenase (TM0441) from Thermotoga maritima at 2.07 A resolution
Deposited on 2004-07-14, released 2004-08-17
The last revision prior to the SCOP 1.71 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.151
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vl8a_
  • Chain 'B':
    Domains in SCOP 1.71: d1vl8b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl8A (A:)
    mgsdkihhhhhhmkevfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleease
    aaqkltekygvetmafrcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpl
    defrqvievnlfgtyyvcreafsllresdnpsiinigsltveevtmpnisayaaskggva
    sltkalakewgrygirvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkg
    vavflaseeakyvtgqiifvdggwtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl8A (A:)
    fdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleeaseaaqkltekygvetmaf
    rcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpldefrqvievnlfgtyy
    vcreafsllresdnpsiinigsltveevtmpnisayaaskggvasltkalakewgrygir
    vnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkgvavflaseeakyvtgq
    iifvdggwtan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl8B (B:)
    mgsdkihhhhhhmkevfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleease
    aaqkltekygvetmafrcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpl
    defrqvievnlfgtyyvcreafsllresdnpsiinigsltveevtmpnisayaaskggva
    sltkalakewgrygirvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkg
    vavflaseeakyvtgqiifvdggwtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl8B (B:)
    vfdlrgrvalvtggsrglgfgiaqglaeagcsvvvasrnleeaseaaqkltekygvetma
    frcdvsnyeevkklleavkekfgkldtvvnaaginrrhpaeefpldefrqvievnlfgty
    yvcreafsllresdnpsiinigsltveevtmpnisayaaskggvasltkalakewgrygi
    rvnviapgwyrtkmteavfsdpekldymlkriplgrtgvpedlkgvavflaseeakyvtg
    qiifvdggwtan