PDB entry 1vl7

View 1vl7 on RCSB PDB site
Description: Crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 A resolution
Deposited on 2004-07-13, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vl7a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl7A (A:)
    mgsdkihhhhhhmsqlekaqaeyagfiqefqsaiistiseqgipngsyapfviddakniy
    iyvsglavhtknieanplvnvlfvddeaktnqifarrrlsfdctatlieresqkwnqvvd
    qfqerfgqiievlrgladfrifqltpkegrfvigfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl7A (A:)
    yagfiqefqsaiistiseqgipngsyapfviddakniyiyvsglavhtknieanplvnvl
    fvddeaktnqifarrrlsfdctatlieresqkwnqvvdqfqerfgqiievlrgladfrif
    qltpkegrfvigfga