PDB entry 1vl7

View 1vl7 on RCSB PDB site
Description: Crystal structure of a putative heme oxygenase (alr5027) from nostoc sp. pcc 7120 at 1.50 A resolution
Class: oxidoreductase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, oxidoreductase
Deposited on 2004-07-13, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.156
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein alr5027
    Species: Nostoc sp. [TaxId:103690]
    Gene: alr5027
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vl7a_
  • Chain 'B':
    Compound: hypothetical protein alr5027
    Species: Nostoc sp. [TaxId:103690]
    Gene: alr5027
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vl7b_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl7A (A:)
    mgsdkihhhhhhmsqlekaqaeyagfiqefqsaiistiseqgipngsyapfviddakniy
    iyvsglavhtknieanplvnvlfvddeaktnqifarrrlsfdctatlieresqkwnqvvd
    qfqerfgqiievlrgladfrifqltpkegrfvigfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl7A (A:)
    yagfiqefqsaiistiseqgipngsyapfviddakniyiyvsglavhtknieanplvnvl
    fvddeaktnqifarrrlsfdctatlieresqkwnqvvdqfqerfgqiievlrgladfrif
    qltpkegrfvigfga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl7B (B:)
    mgsdkihhhhhhmsqlekaqaeyagfiqefqsaiistiseqgipngsyapfviddakniy
    iyvsglavhtknieanplvnvlfvddeaktnqifarrrlsfdctatlieresqkwnqvvd
    qfqerfgqiievlrgladfrifqltpkegrfvigfga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl7B (B:)
    yagfiqefqsaiistiseqgipngsyapfviddakniyiyvsglavhtknieanplvnvl
    fvddeaktnqifarrrlsfdctatlieresqkwnqvvdqfqerfgqiievlrgladfrif
    qltpkegrfvigfga