PDB entry 1vl6

View 1vl6 on RCSB PDB site
Description: Crystal structure of NAD-dependent malic enzyme (TM0542) from Thermotoga maritima at 2.61 A resolution
Deposited on 2004-07-13, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2.61 Å
R-factor: 0.194
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl6A (A:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6A (A:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkie
    evkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnpe
    rlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagaf
    ivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipea
    fdmkvhlnvytavkgsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl6B (B:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6B (B:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekvvv
    ngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnperlsgdl
    etalegadffigvsrkpewvifalanpvpelareagafivatgrsdhpnqvnnllafpgi
    mkgavekrskitknmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vl6C (C:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6C (C:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkie
    evkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnpe
    rlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagaf
    ivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipea
    fdmkvhlnvytavkgsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vl6D (D:)
    mgsdkihhhhhhvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpe
    ktyvytsrwntvavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclsese
    eekiisivkslepsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaafl
    nalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclney
    hleiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpei
    dpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarsc
    epeperiipeafdmkvhlnvytavkgsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl6D (D:)
    hvdalevhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwnt
    vavvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivksl
    epsfgginledigapkcfrilqrlseemnipvfhddqqgtavvvsaaflnalkltekkie
    evkvvvngigaagynivkflldlgvknvvavdrkgilnendpetclneyhleiaritnpe
    rlsgdletalegadffigvsrgnilkpewikkmsrkpvifalanpvpeidpelareagaf
    ivatgrsdhpnqvnnllafpgimkgavekrskitknmllsaveaiarscepeperiipea
    fdmkvhlnvytavkgsa