PDB entry 1vl5

View 1vl5 on RCSB PDB site
Description: crystal structure of a putative methyltransferase (bh2331) from bacillus halodurans c-125 at 1.95 a resolution
Class: transferase
Keywords: putative methyltransferase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, transferase
Deposited on 2004-07-09, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.179
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: unknown conserved protein BH2331
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2331
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAF6
      • modified residue (29)
      • see remark 999 (96)
      • modified residue (175)
      • modified residue (202)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vl5a_
  • Chain 'B':
    Compound: unknown conserved protein BH2331
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2331
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAF6
      • modified residue (29)
      • see remark 999 (96)
      • modified residue (175)
      • modified residue (202)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vl5b_
  • Chain 'C':
    Compound: unknown conserved protein BH2331
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2331
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAF6
      • modified residue (29)
      • see remark 999 (96)
      • modified residue (175)
      • modified residue (202)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vl5c_
  • Chain 'D':
    Compound: unknown conserved protein BH2331
    Species: BACILLUS HALODURANS [TaxId:272558]
    Gene: BH2331
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KAF6
      • modified residue (29)
      • see remark 999 (96)
      • modified residue (175)
      • modified residue (202)
      • modified residue (246)
    Domains in SCOPe 2.07: d1vl5d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl5A (A:)
    mgsdkihhhhhhmyvtsqihakgsdlaklmqiaalkgneevldvatggghvanafapfvk
    kvvafdltedilkvarafiegnghqqveyvqgdaeqmpftderfhivtcriaahhfpnpa
    sfvseayrvlkkggqlllvdnsapendafdvfynyvekerdyshhrawkksdwlkmleea
    gfeleelhcfhktfifedwcdrmnvttekkqelsdfikskpteyyqkfkivvedgrvysf
    rgesilmkarkptvknkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl5A (A:)
    gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn
    ghqqveyvqgdaeqmpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdns
    apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdr
    mnvttekkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl5B (B:)
    mgsdkihhhhhhmyvtsqihakgsdlaklmqiaalkgneevldvatggghvanafapfvk
    kvvafdltedilkvarafiegnghqqveyvqgdaeqmpftderfhivtcriaahhfpnpa
    sfvseayrvlkkggqlllvdnsapendafdvfynyvekerdyshhrawkksdwlkmleea
    gfeleelhcfhktfifedwcdrmnvttekkqelsdfikskpteyyqkfkivvedgrvysf
    rgesilmkarkptvknkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl5B (B:)
    gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn
    ghqqveyvqgdaeqmpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdns
    apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdr
    mnvttekkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vl5C (C:)
    mgsdkihhhhhhmyvtsqihakgsdlaklmqiaalkgneevldvatggghvanafapfvk
    kvvafdltedilkvarafiegnghqqveyvqgdaeqmpftderfhivtcriaahhfpnpa
    sfvseayrvlkkggqlllvdnsapendafdvfynyvekerdyshhrawkksdwlkmleea
    gfeleelhcfhktfifedwcdrmnvttekkqelsdfikskpteyyqkfkivvedgrvysf
    rgesilmkarkptvknkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl5C (C:)
    gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdlqveyvqgdaeqmpft
    derfhivtcriaahhfpnpasfvseayrvlkkggqlllvdnsapendafdvfynyveker
    dyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdrmnvttekkqelsdfiksk
    pteyyqkfkivvedgrvysfrgesilmkarkpt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vl5D (D:)
    mgsdkihhhhhhmyvtsqihakgsdlaklmqiaalkgneevldvatggghvanafapfvk
    kvvafdltedilkvarafiegnghqqveyvqgdaeqmpftderfhivtcriaahhfpnpa
    sfvseayrvlkkggqlllvdnsapendafdvfynyvekerdyshhrawkksdwlkmleea
    gfeleelhcfhktfifedwcdrmnvttekkqelsdfikskpteyyqkfkivvedgrvysf
    rgesilmkarkptvknkgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl5D (D:)
    gsdlaklmqiaalkgneevldvatggghvanafapfvkkvvafdltedilkvarafiegn
    ghqqveyvqgdaeqmpftderfhivtcriaahhfpnpasfvseayrvlkkggqlllvdns
    apendafdvfynyvekerdyshhrawkksdwlkmleeagfeleelhcfhktfifedwcdr
    mnvttekkqelsdfikskpteyyqkfkivvedgrvysfrgesilmkarkpt