PDB entry 1vl4

View 1vl4 on RCSB PDB site
Description: crystal structure of a putative modulator of a DNA gyrase (tm0727) from thermotoga maritima msb8 at 1.95 a resolution
Class: gene regulation
Keywords: pmba-related protein, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, gene regulation
Deposited on 2004-07-09, released 2004-09-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pmbA-related protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0727
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vl4a_
  • Chain 'B':
    Compound: pmbA-related protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM0727
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vl4b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl4A (A:)
    mgsdkihhhhhhmtfeefkdrlfalakkngvevqisfletrefslrlangdldqytdagk
    fnveikvlkdgktgtfrtqvlenpekcfeealsnlqvkdseekeyffeggkeyremetyv
    grfeklsvkekmdmakkahesaakdervvmvptvmykdmvikkiitntlgldvesqmdgg
    flfamaiardanprsgswyelartpedlnpeeigkraaeeaisligsktipsgkypvlmr
    ntalldlmemfipmisaenvqknlsplkgklgeqvgnpavsikdlpyhpkglsstpfdde
    gvpttekfvlengvlktflhnlktarkegveptgngfvggirpvnlmlmpgeksfeellk
    emdrgvvitevegmhagansisgefslfakgywvengeiahgveditisgnfldllrkiv
    lvgndvkvsqhtiapsvlvevldvagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl4A (A:)
    mtfeefkdrlfalakkngvevqisfletrefslrlangdldqytdagkfnveikvlkdgk
    tgtfrtqvlenpekcfeealsnlqvkkeyffeggkeyremetyvgrfeklsvkekmdmak
    kahesaakdervvmvptvmykdmvikkiitntlgldvesqmdggflfamaiardanprsg
    swyelartpedlnpeeigkraaeeaisligsktipsgkypvlmrntalldlmemfipmis
    aenvqknlsplkgklgeqvgnpavsikdlpyhpkglsstpfddegvpttekfvlengvlk
    tflhnlktarkegveptgngfvggirpvnlmlmpgeksfeellkemdrgvvitevegmha
    gansisgefslfakgywvengeiahgveditisgnfldllrkivlvgndvkvsqhtiaps
    vlvevldva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl4B (B:)
    mgsdkihhhhhhmtfeefkdrlfalakkngvevqisfletrefslrlangdldqytdagk
    fnveikvlkdgktgtfrtqvlenpekcfeealsnlqvkdseekeyffeggkeyremetyv
    grfeklsvkekmdmakkahesaakdervvmvptvmykdmvikkiitntlgldvesqmdgg
    flfamaiardanprsgswyelartpedlnpeeigkraaeeaisligsktipsgkypvlmr
    ntalldlmemfipmisaenvqknlsplkgklgeqvgnpavsikdlpyhpkglsstpfdde
    gvpttekfvlengvlktflhnlktarkegveptgngfvggirpvnlmlmpgeksfeellk
    emdrgvvitevegmhagansisgefslfakgywvengeiahgveditisgnfldllrkiv
    lvgndvkvsqhtiapsvlvevldvagk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl4B (B:)
    mtfeefkdrlfalakkngvevqisfletrefslrlangdldqytdagkfnveikvlkdgk
    tgtfrtqvlenpekcfeealsnlqvkkeyffeggkeyremetyvgrfeklsvkekmdmak
    kahesaakdervvmvptvmykdmvikkiitntlgldvesqmdggflfamaiardanprsg
    swyelartpedlnpeeigkraaeeaisligsktipsgkypvlmrntalldlmemfipmis
    aenvqknlsplkgklgeqvgnpavsikdlpyhpkglsstpfddegvpttekfvlengvlk
    tflhnlktarkegveptgngfvggirpvnlmlmpgeksfeellkemdrgvvitevegmha
    gansisgefslfakgywvengeiahgveditisgnfldllrkivlvgndvkvsqhtiaps
    vlvevldva