PDB entry 1vl2

View 1vl2 on RCSB PDB site
Description: Crystal structure of Argininosuccinate synthase (TM1780) from Thermotoga maritima at 1.65 A resolution
Class: ligase
Keywords: TM1780, ARGININOSUCCINATE SYNTHASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, LIGASE
Deposited on 2004-07-08, released 2004-08-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.6500000000000001 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: argininosuccinate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: argG, TM1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vl2a1, d1vl2a2
  • Chain 'B':
    Compound: argininosuccinate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: argG, TM1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vl2b1, d1vl2b2
  • Chain 'C':
    Compound: argininosuccinate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: argG, TM1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vl2c1, d1vl2c2
  • Chain 'D':
    Compound: argininosuccinate synthase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: argG, TM1780
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vl2d1, d1vl2d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl2A (A:)
    mgsdkihhhhhhmkekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikek
    alktgaskvyvedlrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekeg
    aqyvahgatgkgndqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgip
    ikvskkrpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfeng
    ipvkvvnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatil
    wiahrdlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvt
    vsiykgnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvkkgyq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl2A (A:)
    kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
    lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
    dqvrfeltyaalnpnlkvispwkdpeflakfktdlinyamekgipikvskkrpysedenl
    mhisheagkledpahipdedvftwtvspkdapdeetlleihfengipvkvvnlkdgtekt
    dplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahrdlegitmdke
    vmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiykgnvmpvarys
    pyslynpggfdatdskgfinihalrlkvhqlvkkgyqr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vl2B (B:)
    mgsdkihhhhhhmkekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikek
    alktgaskvyvedlrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekeg
    aqyvahgatgkgndqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgip
    ikvskkrpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfeng
    ipvkvvnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatil
    wiahrdlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvt
    vsiykgnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvkkgyq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl2B (B:)
    kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
    lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
    dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipikrpysedenlmh
    isheagkledpahipdedvftwtvspkdapdeetlleihfengipvkvvnlkdgtektdp
    lelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahrdlegitmdkevm
    hlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiykgnvmpvaryspy
    slyngfdatdskgfinihalrlkvhqlvkkgyqr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vl2C (C:)
    mgsdkihhhhhhmkekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikek
    alktgaskvyvedlrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekeg
    aqyvahgatgkgndqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgip
    ikvskkrpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfeng
    ipvkvvnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatil
    wiahrdlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvt
    vsiykgnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvkkgyq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl2C (C:)
    kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
    lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
    dqvrfeltyaalnpnlkvispwkdpeflakfktdlinyamekgipikvskkrpysedenl
    mhisheagkledpahipdedvftwtvspkdapdeetlleihfengipvkvvnlkdgtekt
    dplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahrdlegitmdke
    vmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiykgnvmpvarys
    pyslynpggfdatdskgfinihalrlkvhqlvk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vl2D (D:)
    mgsdkihhhhhhmkekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikek
    alktgaskvyvedlrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekeg
    aqyvahgatgkgndqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgip
    ikvskkrpysedenlmhisheagkledpahipdedvftwtvspkdapdeetlleihfeng
    ipvkvvnlkdgtektdplelfeylnevgakngvgrldmvenrfigiksrgvyetpgatil
    wiahrdlegitmdkevmhlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvt
    vsiykgnvmpvaryspyslynpelssmdveggfdatdskgfinihalrlkvhqlvkkgyq
    r
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl2D (D:)
    kekvvlaysggldtsvilkwlcekgfdviayvanvgqkddfvaikekalktgaskvyved
    lrrefvtdyiftallgnamyegryllgtaiarpliakrqveiaekegaqyvahgatgkgn
    dqvrfeltyaalnpnlkvispwkdpeflakfkgrtdlinyamekgipikrpysedenlmh
    isheagkledpahipdedvftwtvspkdapdeetlleihfengipvkvvnlkdgtektdp
    lelfeylnevgakngvgrldmvenrfigiksrgvyetpgatilwiahrdlegitmdkevm
    hlrdmlapkfaeliyngfwfspemefllaafrkaqenvtgkvtvsiykgnvmpvaryspy
    slyngfdatdskgfinihalrlkvhqlvk