PDB entry 1vl1

View 1vl1 on RCSB PDB site
Description: Crystal structure of 6-phosphogluconolactonase (TM1154) from Thermotoga maritima at 1.70A resolution
Class: hydrolase
Keywords: TM1154, 6-PHOSPHOGLUCONOLACTONASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2004-06-30, released 2004-08-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.167
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 6-phosphogluconolactonase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: PGL, DEVB, TM1154
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vl1a_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vl1A (A:)
    mgsdkihhhhhhmektviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpv
    yeklaeqkfpwnrihfflsderyvpldsdqsnfrninevlfsrakipsgnvhyvdtslpi
    ekacekyereirsatdqfdlailgmgpdghvasifdletgnkdnlvtftdpsgdpkvprv
    tltfralntslyvlflirgkekinrlteilkdtplpayfvrgkektvwfvgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vl1A (A:)
    ktviylledgyvdfvvekirtkmeklleekdkifvvlaggrtplpvyeklaeqkfpwnri
    hfflsderyvpldsdqsnfrninevlfsrakipsgnvhyvdtslpiekacekyereirsa
    tdqfdlailgmgpdghvasifdletgnkdnlvtftdpsgdpkvprvtltfralntslyvl
    flirgkekinrlteilkdtplpayfvrgkektvwfvgk