PDB entry 1vkz

View 1vkz on RCSB PDB site
Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
Deposited on 2004-06-29, released 2004-08-24
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-24, with a file datestamp of 2004-08-24.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkzA (A:)
    mgsdkihhhhhhmkavrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpye
    gektlkaipeedivipgseeflvegvsnwrsnvfgpvkevarlegskvyakrfmkkygir
    tarfevaetpeelrekikkfsppyvikadglargkgvlildskeetiekgskliigelik
    gvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdrgpntggmgswgpvei
    psdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyileynvrlgdpetevivt
    lnpegfvnavlegyrggkmepveprgfavdvvlaargypdapekgkeitlpeegliffag
    vaekdgklvtnggrvlhcmgtgetkeearrkayelaekvhfegktyrrdial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkzA (A:)
    vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
    pgseeflversnvfgpvkevarlegskvyakrfmkkygirtarfevaetpeelrekikkf
    sppyvikadglargkgvlildskeetiekgskliigelikgvkgpvvideflagnelsam
    avvngrnfvilpfvrdykrlmdgdrgpntggmgswgpveipsdtikkieelfdktlwgve
    kegyayrgflylglmlhdgdpyileynvrlgdpetevivtlnpegfvnavlegyrggkme
    pveprgfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmg
    tgetkeearrkayelaekvhfegktyrrdia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkzB (B:)
    mgsdkihhhhhhmkavrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpye
    gektlkaipeedivipgseeflvegvsnwrsnvfgpvkevarlegskvyakrfmkkygir
    tarfevaetpeelrekikkfsppyvikadglargkgvlildskeetiekgskliigelik
    gvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdrgpntggmgswgpvei
    psdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyileynvrlgdpetevivt
    lnpegfvnavlegyrggkmepveprgfavdvvlaargypdapekgkeitlpeegliffag
    vaekdgklvtnggrvlhcmgtgetkeearrkayelaekvhfegktyrrdial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkzB (B:)
    vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
    pgseeflversnvfgpvkevarlegskvyakrfmkkygirtarfevaetpeelrekikkf
    sppyvikadglargkgvlildskeetiekgskliigelikgvkgpvvideflagnelsam
    avvngrnfvilpfvrdykrlmdgdrgpntggmgswgpveipsdtikkieelfdktlwgve
    kegyayrgflylglmlhdgdpyileynvrlgdpetevivtlnpegfvnavlegyrggkme
    pveprgfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmg
    tgetkeearrkayelaekvhfegktyrrdia