PDB entry 1vkz

View 1vkz on RCSB PDB site
Description: Crystal structure of Phosphoribosylamine--glycine ligase (TM1250) from Thermotoga maritima at 2.30 A resolution
Class: ligase
Keywords: TM1250, PHOSPHORIBOSYLAMINE--GLYCINE LIGASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, LIGASE
Deposited on 2004-06-29, released 2004-08-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.216
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purD, TM1250
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0X7
      • modified residue (113)
      • modified residue (199)
      • modified residue (220)
      • modified residue (231)
      • modified residue (274)
      • modified residue (318)
      • modified residue (378)
    Domains in SCOPe 2.07: d1vkza1, d1vkza2, d1vkza3
  • Chain 'B':
    Compound: Phosphoribosylamine--glycine ligase
    Species: Thermotoga maritima [TaxId:2336]
    Gene: purD, TM1250
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0X7
      • modified residue (113)
      • modified residue (199)
      • modified residue (220)
      • modified residue (231)
      • modified residue (274)
      • modified residue (318)
      • modified residue (378)
    Domains in SCOPe 2.07: d1vkzb1, d1vkzb2, d1vkzb3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkzA (A:)
    mgsdkihhhhhhmkavrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpye
    gektlkaipeedivipgseeflvegvsnwrsnvfgpvkevarlegskvyakrfmkkygir
    tarfevaetpeelrekikkfsppyvikadglargkgvlildskeetiekgskliigelik
    gvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdrgpntggmgswgpvei
    psdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyileynvrlgdpetevivt
    lnpegfvnavlegyrggkmepveprgfavdvvlaargypdapekgkeitlpeegliffag
    vaekdgklvtnggrvlhcmgtgetkeearrkayelaekvhfegktyrrdial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkzA (A:)
    vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
    pgseeflversnvfgpvkevarlegskvyakrfmkkygirtarfevaetpeelrekikkf
    sppyvikadglargkgvlildskeetiekgskliigelikgvkgpvvideflagnelsam
    avvngrnfvilpfvrdykrlmdgdrgpntggmgswgpveipsdtikkieelfdktlwgve
    kegyayrgflylglmlhdgdpyileynvrlgdpetevivtlnpegfvnavlegyrggkme
    pveprgfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmg
    tgetkeearrkayelaekvhfegktyrrdia
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkzB (B:)
    mgsdkihhhhhhmkavrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpye
    gektlkaipeedivipgseeflvegvsnwrsnvfgpvkevarlegskvyakrfmkkygir
    tarfevaetpeelrekikkfsppyvikadglargkgvlildskeetiekgskliigelik
    gvkgpvvideflagnelsamavvngrnfvilpfvrdykrlmdgdrgpntggmgswgpvei
    psdtikkieelfdktlwgvekegyayrgflylglmlhdgdpyileynvrlgdpetevivt
    lnpegfvnavlegyrggkmepveprgfavdvvlaargypdapekgkeitlpeegliffag
    vaekdgklvtnggrvlhcmgtgetkeearrkayelaekvhfegktyrrdial
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkzB (B:)
    vrvhilgsggrehaigwafakqgyevhfypgnagtkrdgtnhpyegektlkaipeedivi
    pgseeflversnvfgpvkevarlegskvyakrfmkkygirtarfevaetpeelrekikkf
    sppyvikadglargkgvlildskeetiekgskliigelikgvkgpvvideflagnelsam
    avvngrnfvilpfvrdykrlmdgdrgpntggmgswgpveipsdtikkieelfdktlwgve
    kegyayrgflylglmlhdgdpyileynvrlgdpetevivtlnpegfvnavlegyrggkme
    pveprgfavdvvlaargypdapekgkeitlpeegliffagvaekdgklvtnggrvlhcmg
    tgetkeearrkayelaekvhfegktyrrdia