PDB entry 1vky

View 1vky on RCSB PDB site
Description: Crystal structure of S-adenosylmethionine tRNA ribosyltransferase (TM0574) from Thermotoga maritima at 2.00 A resolution
Deposited on 2004-06-28, released 2004-08-17
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-17, with a file datestamp of 2004-08-17.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vkya_
  • Chain 'B':
    Domains in SCOP 1.69: d1vkyb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkyA (A:)
    mgsdkihhhhhhmkvsefdyelppeliaqepveprdasrlmvlhrktqriehrifreiie
    ylepgdllvlnvskviparlyarkktgasieillierleegiwkclvrpgqkvkkgtelv
    idedlsavclgrgedgtrilkfqpqddrlifekgrtplppyiknevpleryqtvyakeeg
    svaaptaglhftpelieklkkkgvqfaevvlhvgigtfrpvkveevekhkmheefyqvpk
    etvrklretrergnrivavgtttvrtletiarlpeqeeyvgktdlfiyppfefklvdalv
    tnfhlprstllmlvaafagkdfvmeayreavkrryrffsfgdamlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkyA (A:)
    sefdyelppeliaqepveprdasrlmvlhrktqriehrifreiieylepgdllvlnvskv
    iparlyarkasieillierleegiwkclvrpgqkvkkgtelvidedlsavclgrgedgtr
    ilkfqpqddrlifekgtaglhftpelieklkkkgvqfaevvlhvheefyqvpketvrklr
    etrergnrivavgtttvrtletiarlpeqeeyvgktdlfiyppfefklvdalvtnfhlpr
    stllmlvaafagkdfvmeayreavkrryrffsfgdamlil
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkyB (B:)
    mgsdkihhhhhhmkvsefdyelppeliaqepveprdasrlmvlhrktqriehrifreiie
    ylepgdllvlnvskviparlyarkktgasieillierleegiwkclvrpgqkvkkgtelv
    idedlsavclgrgedgtrilkfqpqddrlifekgrtplppyiknevpleryqtvyakeeg
    svaaptaglhftpelieklkkkgvqfaevvlhvgigtfrpvkveevekhkmheefyqvpk
    etvrklretrergnrivavgtttvrtletiarlpeqeeyvgktdlfiyppfefklvdalv
    tnfhlprstllmlvaafagkdfvmeayreavkrryrffsfgdamlil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkyB (B:)
    sefdyelppeliaqepveprdasrlmvlhrktqriehrifreiieylepgdllvlnvskv
    iparlyarkgasieillierleegiwkclvrpgqkvkkgtelvidedlsavclgrgedgt
    rilkfqpqddrlifekgtaglhftpelieklkkkgvqfaevvlhvgiheefyqvpketvr
    klretrergnrivavgtttvrtletiarlpeqeeyvgktdlfiyppfefklvdalvtnfh
    lprstllmlvaafagkdfvmeayreavkrryrffsfgdamlil