PDB entry 1vkw

View 1vkw on RCSB PDB site
Description: Crystal structure of a putative nitroreductase (tm1586) from thermotoga maritima msb8 at 2.00 A resolution
Class: oxidoreductase
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, oxidoreductase
Deposited on 2004-06-24, released 2004-09-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.212
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative nitroreductase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1586
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1S2 (12-217)
      • leader sequence (1-11)
      • modified residue (12)
      • modified residue (32)
      • modified residue (100)
      • modified residue (150)
    Domains in SCOPe 2.06: d1vkwa1, d1vkwa2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkwA (A:)
    mgsdkihhhhhhmnifeaienrhsvrdflerkmpervkddienllvkfitkkldwkinls
    sfpsyiyakaekhfdelveygfqgeqivlfltaqgfgtcwmarsphpdvpyiivfgyprt
    rnftrkrrpitsflendleelppeivkivemtilapsalnrqpwkikytggelcisserp
    vdlgialshayltareifkrepviqkrgedtyclilnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkwA (A:)
    gsdkihhhhhhmnifeaienrhsvrdflerkmpervkddienllvkfitkkldwkinlss
    fpsyiyakaekhfdelveygfqgeqivlfltaqgfgtcwmarsphpdvpyiivfgyprtr
    nftrkrrpitsflendleelppeivkivemtilapsalnrqpwkikytggelcisserpv
    dlgialshayltareifkrepviqkrgedtyclilnp