PDB entry 1vkv

View 1vkv on RCSB PDB site
Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At5g18200
Deposited on 2004-06-24, released 2004-08-10
The last revision was dated 2005-06-14, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: expressed protein
    Species: Arabidopsis thaliana
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed):
    • GB NP_197321 (Start-350)
      • see remark 999 (55-60)
  • Chain 'B':
    Compound: expressed protein
    Species: Arabidopsis thaliana
    Gene: At5g18200
    Database cross-references and differences (RAF-indexed):
    • GB NP_197321
      • see remark 999 (56-60)
  • Heterogens: ZN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1vkvA (A:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifspxxxxxxxxxxxxxxxxxxxxx
    xscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records):
    >1vkvA (A:)
    pelrkdpvtnrwvifspxxxxxxscpfcigreqecapelfrvpdhdpnwklrvienlypa
    lsrnletrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyi
    qvfknqgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvi
    desshfvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndp
    pynymihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrev
    slt
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1vkvB (B:)
    mtspshasdrgggdgdsvenqspelrkdpvtnrwvifspxxxxxxxxxxxxxxxxxxxxx
    xscpfcigreqecapelfrvpdhdpnwklrvienlypalsrnletqstqpetgtsrtivg
    fgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfknqgasaga
    smshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidesshfvsvapf
    aatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynymihtsplk
    vtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevslt
    

    Sequence, based on observed residues (ATOM records):
    >1vkvB (B:)
    spelrkdpvtnrwvifspxxxxxscpfcicapelfrvpdhdpnwklrvienlypalsrnl
    etrtivgfgfhdvviespvhsiqlsdidpvgigdiliaykkrinqiaqhdsinyiqvfkn
    qgasagasmshshsqmmalpvvpptvssrldgtkdyfeetgkcclceakskhfvidessh
    fvsvapfaatypfeiwiipkdhsshfhhlddvkavdlggllklmlqkiakqlndppynym
    ihtsplkvtesqlpythwflqivpqlsgvggfeigtgcyinpvfpedvakvmrevsl