PDB entry 1vkt

View 1vkt on RCSB PDB site
Description: human insulin two disulfide model, nmr, 10 structures
Class: hormone
Keywords: hormone, human insulin, disulfide model
Deposited on 1996-10-14, released 1997-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-20)
      • engineered (5)
      • engineered (10)
    Domains in SCOPe 2.07: d1vkt.1
  • Chain 'B':
    Compound: insulin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01308 (0-29)
      • engineered (9)
      • engineered (27-28)
    Domains in SCOPe 2.07: d1vkt.1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vktA (A:)
    giveqsctsisslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vktB (B:)
    fvnqhlcgsdlvealylvcgergffytkpt