PDB entry 1vks

View 1vks on RCSB PDB site
Description: nmr structure of human insulin mutant his-b10-asp, pro-b28-lys, lys-b29-pro, 10 structures
Deposited on 1996-10-14, released 1997-04-01
The last revision was dated 2002-05-29, with a file datestamp of 2007-04-25.
Experiment type: NMR10
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: insulin
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01316 (0-29)
      • engineered (9)
      • engineered (27-28)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1vksA (A:)
    giveqcctsicslyqlenycn
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1vksB (B:)
    fvnqhlcgsdlvealylvcgergffytkpt