PDB entry 1vkr

View 1vkr on RCSB PDB site
Description: structure of iib domain of the mannitol-specific permease enzyme II
Class: transferase
Keywords: phosphotransferase, transferase, kinase, sugar transport
Deposited on 2004-06-14, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mannitol-specific PTS system enzyme IIABC components
    Species: Escherichia coli [TaxId:83334]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkrA (A:)
    gsagdvtndlshvrkiivacdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdv
    dlvithrdlteramrqvpqaqhisltnfldsglytslterlvaaqrhtenevkvkdslkd
    sfdds
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkrA (A:)
    shvrkiivacdagmgssamgagvlrkkiqdaglsqisvtnsainnlppdvdlvithrdlt
    eramrqvpqaqhisltnfldsglytslterlvaaqrh