PDB entry 1vkq

View 1vkq on RCSB PDB site
Description: A re-determination of the structure of the triple mutant (K53,56,120M) of phospholipase A2 at 1.6A resolution using sulphur-SAS at 1.54A wavelength
Class: hydrolase
Keywords: Alpha Helix, Beta Sheet, Triple mutant, Calcium ion
Deposited on 2004-06-12, released 2004-08-31
The last revision prior to the SCOP 1.73 freeze date was dated 2004-08-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: phospholipase a2
  Species: BOS TAURUS
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00593 (0-122)
    • engineered (52)
    • engineered (55)
    • engineered (119)
  Domains in SCOP 1.73: d1vkqa_
• Heterogens: CA, CL, MPD, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1vkqA (A:)
  alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
  ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
  knc