PDB entry 1vkq

View 1vkq on RCSB PDB site
Description: a re-determination of the structure of the triple mutant (k53,56,120m) of phospholipase a2 at 1.6a resolution using sulphur-sas at 1.54a wavelength
Deposited on 2004-06-12, released 2004-08-31
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-31, with a file datestamp of 2004-08-31.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.179
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vkqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vkqA (A:)
    alwqfngmikckipsseplldfnnygcycglggsgtpvddldrccqthdncymqamklds
    ckvlvdnpytnnysyscsnneitcssennaceaficncdrnaaicfskvpynkehknldm
    knc