PDB entry 1vko

View 1vko on RCSB PDB site
Description: Crystal structure of inositol-3-phosphate synthase (ce21227) from Caenorhabditis elegans at 2.30 A resolution
Class: isomerase
Keywords: ce21227, INOSITOL-3-PHOSPHATE SYNTHASE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, ISOMERASE
Deposited on 2004-06-11, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Inositol-3-phosphate synthase
    Species: Caenorhabditis elegans [TaxId:6239]
    Gene: ce21227
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkoa1, d1vkoa2
  • Heterogens: K, CL, IOD, NAD, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkoA (A:)
    mgsdkihhhhhhmssaqvngiskrlivespnvkledgvlesrftyrknhfehradglhvt
    pkehdysfktvlkprktglllvglggnngstavgsifanqyamtwrtkeghsqanyfgsv
    tqtatvhlgydsatqnqifvpfkdivpilspndliisgwdisdsnlyeamgrakvfepel
    qeklrpfmepivplpsiyypdfiasnqgdrannvipgdnklehlehiradirkfkqehel
    ecvivlwtanterytdvrqglnatadeimesirvnedevspsnifavasilegahyings
    pqntlvpglielaerhkvfvggddfksgqtkfksafvdflvssgmkpesivsynhlgnnd
    gknlsearqfrskeiskssvvddmvksnqilfpdaknpdycvvikyvpyvadskramdey
    icsifmggkqtfvvhntcedsllaspliydlailtelasrvsykvddeykpfhsvlsils
    lllkapvvppgtpisnafmrqfstltklvtalagfpsdtdmqiefftqlpaaksksq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkoA (A:)
    krlivespnvkledgvlesrftyrknhfehradglhvtpkehdysfktvlkprktglllv
    glggnngstavgsifanqyamtwrtkeghsqanyfgsvtqtatvhlgydsatqnqifvpf
    kdivpilspndliisgwdisdsnlyeamgrakvfepelqeklrpfmepivplpsiyypdf
    iasnqgdrannvipgdnklehlehiradirkfkqehelecvivlwtanterytdvrqgln
    atadeimesirvnedevspsnifavasilegahyingspqntlvpglielaerhkvfvgg
    ddfksgqtkfksafvdflvssgmkpesivsynhlgnndgknlsearqfrskeiskssvvd
    dmvksnqilfpdaknpdycvvikyvpyvadskramdeyicsifmggkqtfvvhntcedsl
    laspliydlailtelasrvsykvddeykpfhsvlsilslllkapvvppgtpisnafmrqf
    stltklvtalagfpsdtdmqiefftqlpaak