PDB entry 1vkn

View 1vkn on RCSB PDB site
Description: Crystal structure of N-acetyl-gamma-glutamyl-phosphate reductase (TM1782) from Thermotoga maritima at 1.80 A resolution
Deposited on 2004-06-11, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.179
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vknA (A:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknA (A:)
    hmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefd
    pekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyen
    ikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsga
    grkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgils
    tiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntl
    ilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vknB (B:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknB (B:)
    hmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefd
    pekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyen
    ikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsga
    grkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgils
    tiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntl
    ilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vknC (C:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknC (C:)
    miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp
    ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni
    krvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsgae
    kvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyv
    ktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntlilms
    aidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vknD (D:)
    mgsdkihhhhhhmiragiigatgytglelvrllknhpeakitylssrtyagkkleeifps
    tlensilsefdpekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyre
    wygkelsgyenikrvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpeti
    lvdaksgvsgagrkekvdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftp
    hlvpmtrgilstiyvktdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfi
    gmqmeertntlilmsaidnlvkgasgqavqnmnimfgldetkgleftpiyp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vknD (D:)
    miragiigatgytglelvrllknhpeakitylssrtyagkkleeifpstlensilsefdp
    ekvskncdvlftalpagasydlvrelkgvkiidlgadfrfddpgvyrewygkelsgyeni
    krvyglpelhreeiknaqvvgnpgcyptsvilalapalkhnlvdpetilvdaksgvsgek
    vdylfsevneslrpynvakhrhvpemeqelgkisgkkvnvvftphlvpmtrgilstiyvk
    tdksleeiheaylefyknepfvhvlpmgiypstkwcygsnhvfigmqmeertntlilmsa
    idnlvkgasgqavqnmnimfgldetkgleftpiyp