SCOPe 2.06: Structural Classification of Proteins

PDB entry 1vkm

View 1vkm on RCSB PDB site
Description: Crystal structure of an indigoidine synthase a (idga)-like protein (tm1464) from thermotoga maritima msb8 at 1.90 A resolution
Class: biosynthetic protein
Keywords: Indigoidine synthase a-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, biosynthetic protein
Deposited on 2004-06-09, released 2004-06-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: conserved hypothetical protein TM1464
Species: THERMOTOGA MARITIMA [TaxId:243274]
Gene: TM1464
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X1H5 (12-End)
  - leader sequence (4-11)
  - see remark 999 (12)
  - modified residue (27)
  - modified residue (73)
  - modified residue (81-82)
  - modified residue (145)
  - modified residue (169)
  - modified residue (213)
  - modified residue (216)
  - modified residue (223)
  - modified residue (266)
Domains in SCOPe 2.06: d1vkma1, d1vkma2
Chain 'B':
Compound: conserved hypothetical protein TM1464
Species: THERMOTOGA MARITIMA [TaxId:243274]
Gene: TM1464
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X1H5 (12-End)
  - leader sequence (4-11)
  - see remark 999 (12)
  - modified residue (27)
  - modified residue (73)
  - modified residue (81-82)
  - modified residue (145)
  - modified residue (169)
  - modified residue (213)
  - modified residue (216)
  - modified residue (223)
  - modified residue (266)
Domains in SCOPe 2.06: d1vkmb1, d1vkmb2
Chain 'C':
Compound: conserved hypothetical protein TM1464
Species: THERMOTOGA MARITIMA [TaxId:243274]
Gene: TM1464
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X1H5 (12-End)
  - leader sequence (4-11)
  - see remark 999 (12)
  - modified residue (27)
  - modified residue (73)
  - modified residue (81-82)
  - modified residue (145)
  - modified residue (169)
  - modified residue (213)
  - modified residue (216)
  - modified residue (223)
  - modified residue (266)
Domains in SCOPe 2.06: d1vkmc1, d1vkmc2
Chain 'D':
Compound: conserved hypothetical protein TM1464
Species: THERMOTOGA MARITIMA [TaxId:243274]
Gene: TM1464
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X1H5 (12-End)
  - leader sequence (4-11)
  - see remark 999 (12)
  - modified residue (27)
  - modified residue (73)
  - modified residue (81-82)
  - modified residue (145)
  - modified residue (169)
  - modified residue (213)
  - modified residue (216)
  - modified residue (223)
  - modified residue (266)
Domains in SCOPe 2.06: d1vkmd1, d1vkmd2
Chain 'E':
Compound: conserved hypothetical protein TM1464
Species: THERMOTOGA MARITIMA [TaxId:243274]
Gene: TM1464
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X1H5 (12-End)
  - leader sequence (4-11)
  - see remark 999 (12)
  - modified residue (27)
  - modified residue (73)
  - modified residue (81-82)
  - modified residue (145)
  - modified residue (169)
  - modified residue (213)
  - modified residue (216)
  - modified residue (223)
  - modified residue (266)
Domains in SCOPe 2.06: d1vkme1, d1vkme2
Chain 'F':
Compound: conserved hypothetical protein TM1464
Species: THERMOTOGA MARITIMA [TaxId:243274]
Gene: TM1464
Database cross-references and differences (RAF-indexed):
- Uniprot Q9X1H5 (12-End)
  - leader sequence (4-11)
  - see remark 999 (12)
  - modified residue (27)
  - modified residue (73)
  - modified residue (81-82)
  - modified residue (145)
  - modified residue (169)
  - modified residue (213)
  - modified residue (216)
  - modified residue (223)
  - modified residue (266)
Domains in SCOPe 2.06: d1vkmf1, d1vkmf2
Heterogens: MN, UNL, EDO, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>1vkmA (A:)
mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs