PDB entry 1vkm

View 1vkm on RCSB PDB site
Description: Crystal structure of an indigoidine synthase a (idga)-like protein (tm1464) from thermotoga maritima msb8 at 1.90 A resolution
Deposited on 2004-06-09, released 2004-06-29
The last revision prior to the SCOP 1.69 freeze date was dated 2004-08-10, with a file datestamp of 2004-08-10.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1vkma_
  • Chain 'B':
    Domains in SCOP 1.69: d1vkmb_
  • Chain 'C':
    Domains in SCOP 1.69: d1vkmc_
  • Chain 'D':
    Domains in SCOP 1.69: d1vkmd_
  • Chain 'E':
    Domains in SCOP 1.69: d1vkme_
  • Chain 'F':
    Domains in SCOP 1.69: d1vkmf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkmA (A:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmA (A:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkmB (B:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmB (B:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vkmC (C:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmC (C:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vkmD (D:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmD (D:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vkmE (E:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmE (E:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vkmF (F:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmF (F:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr