PDB entry 1vkm

View 1vkm on RCSB PDB site
Description: Crystal structure of an indigoidine synthase a (idga)-like protein (tm1464) from thermotoga maritima msb8 at 1.90 A resolution
Class: biosynthetic protein
Keywords: Indigoidine synthase a-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, biosynthetic protein
Deposited on 2004-06-09, released 2004-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.156
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TM1464
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H5 (12-End)
      • leader sequence (4-11)
      • see remark 999 (12)
      • modified residue (27)
      • modified residue (73)
      • modified residue (81-82)
      • modified residue (145)
      • modified residue (169)
      • modified residue (213)
      • modified residue (216)
      • modified residue (223)
      • modified residue (266)
    Domains in SCOPe 2.07: d1vkma1, d1vkma2
  • Chain 'B':
    Compound: conserved hypothetical protein TM1464
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H5 (12-End)
      • leader sequence (4-11)
      • see remark 999 (12)
      • modified residue (27)
      • modified residue (73)
      • modified residue (81-82)
      • modified residue (145)
      • modified residue (169)
      • modified residue (213)
      • modified residue (216)
      • modified residue (223)
      • modified residue (266)
    Domains in SCOPe 2.07: d1vkmb1, d1vkmb2
  • Chain 'C':
    Compound: conserved hypothetical protein TM1464
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H5 (12-End)
      • leader sequence (4-11)
      • see remark 999 (12)
      • modified residue (27)
      • modified residue (73)
      • modified residue (81-82)
      • modified residue (145)
      • modified residue (169)
      • modified residue (213)
      • modified residue (216)
      • modified residue (223)
      • modified residue (266)
    Domains in SCOPe 2.07: d1vkmc1, d1vkmc2
  • Chain 'D':
    Compound: conserved hypothetical protein TM1464
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H5 (12-End)
      • leader sequence (4-11)
      • see remark 999 (12)
      • modified residue (27)
      • modified residue (73)
      • modified residue (81-82)
      • modified residue (145)
      • modified residue (169)
      • modified residue (213)
      • modified residue (216)
      • modified residue (223)
      • modified residue (266)
    Domains in SCOPe 2.07: d1vkmd1, d1vkmd2
  • Chain 'E':
    Compound: conserved hypothetical protein TM1464
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H5 (12-End)
      • leader sequence (4-11)
      • see remark 999 (12)
      • modified residue (27)
      • modified residue (73)
      • modified residue (81-82)
      • modified residue (145)
      • modified residue (169)
      • modified residue (213)
      • modified residue (216)
      • modified residue (223)
      • modified residue (266)
    Domains in SCOPe 2.07: d1vkme1, d1vkme2
  • Chain 'F':
    Compound: conserved hypothetical protein TM1464
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1464
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1H5 (12-End)
      • leader sequence (4-11)
      • see remark 999 (12)
      • modified residue (27)
      • modified residue (73)
      • modified residue (81-82)
      • modified residue (145)
      • modified residue (169)
      • modified residue (213)
      • modified residue (216)
      • modified residue (223)
      • modified residue (266)
    Domains in SCOPe 2.07: d1vkmf1, d1vkmf2
  • Heterogens: MN, UNL, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkmA (A:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmA (A:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkmB (B:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmB (B:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vkmC (C:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmC (C:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vkmD (D:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmD (D:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vkmE (E:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmE (E:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vkmF (F:)
    mgsdkihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfql
    avigilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrig
    ievvvtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvg
    frtnefplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdei
    erllekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkmF (F:)
    kihhhhhhviiesriekgkpvvgmettvfvhglprkeaielfrrakeisrekgfqlavig
    ilkgkivagmseeeleammregadkvgtreipivvaegknaattvsatiflsrrigievv
    vtggtggvhpgrvdvsqdltemsssravlvssgiksildveatfemletleiplvgfrtn
    efplffsrksgrrvprienveevlkiyesmkemelektlmvlnpvpeeyeiphdeierll
    ekielevegkevtpfllkklvemtngrtlkanlalleenvklageiavklkr