PDB entry 1vkl

View 1vkl on RCSB PDB site
Description: rabbit muscle phosphoglucomutase
Class: phosphotransferase
Keywords: phosphoglucomutase, phosphotransferase
Deposited on 1996-07-03, released 1997-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.17
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglucomutase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00949 (0-560)
      • conflict (115)
    Domains in SCOPe 2.07: d1vkla1, d1vkla2, d1vkla3, d1vkla4
  • Chain 'B':
    Compound: phosphoglucomutase
    Species: Oryctolagus cuniculus [TaxId:9986]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00949 (0-560)
      • conflict (115)
    Domains in SCOPe 2.07: d1vklb1, d1vklb2, d1vklb3, d1vklb4
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vklA (A:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1vklB (B:)
    vkivtvktkaypdqkpgtsglrkrvkvfqsstnyaenfiqsiistvepaqrqeatlvvgg
    dgrfymkeaiqlivriaaangigrlvigqngilstpavsciirkikaiggiiltashnpg
    gpngdfgikfnisnggpapeaitdkifqisktieeyaicpdlkvdlgvlgkqqfdlenkf
    kpftveivdsveayatmlrnifdfnalkellsgpnrlkiridamhgvvgpyvkkilceel
    gapansavncvpledfgghhpdpnltyaadlvetmksgehdfgaafdgdgdrnmilgkhg
    ffvnpsdsvaviaanifsipyfqqtgvrgfarsmptsgaldrvanatkialyetptgwkf
    fgnlmdasklslcgeesfgtgsdhirekdglwavlawlsilatrkqsvedilkdhwhkfg
    rnfftrydyeeveaegatkmmkdlealmfdrsfvgkqfsandkvytvekadnfeyhdpvd
    gsvsknqglrlifadgsriifrlsgtgsagatirlyidsyekdnakinqdpqvmlaplis
    ialkvsqlqertgrtaptvit