PDB entry 1vkk

View 1vkk on RCSB PDB site
Description: Crystal structure of Glia maturation factor-gamma (GMFG) from Mus musculus at 1.50 A resolution
Class: hormone/growth factor
Keywords: 15079298, GMFG, GLIA MATURATION FACTOR-GAMMA, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, HORMONE-GROWTH FACTOR COMPLEX
Deposited on 2004-05-27, released 2004-08-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.16
AEROSPACI score: 0.74 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glia maturation factor gamma
    Species: Mus musculus [TaxId:10090]
    Gene: GMFG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkka_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkkA (A:)
    mgsdkihhhhhhmsdslvvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvlede
    lqnispeelklelperqprfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsk
    nrlvqtaeltkvfeirttddltetwlkeklaffr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkkA (A:)
    vvcevdpelketlrkfrfrketnnaaiimkvdkdrqmvvledelqnispeelklelperq
    prfvvysykyvhddgrvsyplcfifsspvgckpeqqmmyagsknrlvqtaeltkvfeirt
    tddltetwlkeklaffr