PDB entry 1vkj

View 1vkj on RCSB PDB site
Description: Crystal structure of heparan sulfate 3-O-sulfotransferase isoform 1 in the presence of PAP
Class: transferase
Keywords: sulfotransferase, heparan sulfate, PAP, PAPSS, TRANSFERASE
Deposited on 2004-05-25, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heparan sulfate (glucosamine) 3-O-sulfotransferase 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkja_
  • Chain 'B':
    Compound: heparan sulfate (glucosamine) 3-O-sulfotransferase 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkjb_
  • Chain 'C':
    Compound: heparan sulfate (glucosamine) 3-O-sulfotransferase 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkjc_
  • Heterogens: SO4, A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkjA (A:)
    mgsshhhhhhssglvprgshmgtasngstqqlpqtiiigvrkggtrallemlslhpdvaa
    aenevhffdweehysqglgwyltqmpfssphqltvektpayftspkvperihsmnptirl
    llilrdpservlsdytqvlynhlqkhkpyppiedllmrdgrlnldykalnrslyhahmln
    wlrffplghihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgk
    drclheskgrahpqvdpklldklheyfhepnkkffklvgrtfdwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkjA (A:)
    stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
    ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
    pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
    kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
    hepnkkffklvgrtfdwh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkjB (B:)
    mgsshhhhhhssglvprgshmgtasngstqqlpqtiiigvrkggtrallemlslhpdvaa
    aenevhffdweehysqglgwyltqmpfssphqltvektpayftspkvperihsmnptirl
    llilrdpservlsdytqvlynhlqkhkpyppiedllmrdgrlnldykalnrslyhahmln
    wlrffplghihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgk
    drclheskgrahpqvdpklldklheyfhepnkkffklvgrtfdwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkjB (B:)
    stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
    ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
    pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
    kverflklspqinasnfyfnktkgfyclrdsgkdrclheskgrahpqvdpklldklheyf
    hepnkkffklvgrtfdwh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vkjC (C:)
    mgsshhhhhhssglvprgshmgtasngstqqlpqtiiigvrkggtrallemlslhpdvaa
    aenevhffdweehysqglgwyltqmpfssphqltvektpayftspkvperihsmnptirl
    llilrdpservlsdytqvlynhlqkhkpyppiedllmrdgrlnldykalnrslyhahmln
    wlrffplghihivdgdrlirdpfpeiqkverflklspqinasnfyfnktkgfyclrdsgk
    drclheskgrahpqvdpklldklheyfhepnkkffklvgrtfdwh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkjC (C:)
    stqqlpqtiiigvrkggtrallemlslhpdvaaaenevhffdweehysqglgwyltqmpf
    ssphqltvektpayftspkvperihsmnptirlllilrdpservlsdytqvlynhlqkhk
    pyppiedllmrdgrlnldykalnrslyhahmlnwlrffplghihivdgdrlirdpfpeiq
    kverflklspqinasnfyfnktkgfyclrdsgkdrcvdpklldklheyfhepnkkffklv
    grtfdwh