PDB entry 1vki

View 1vki on RCSB PDB site
Description: Crystal structure of a putative oligo-nucleotide binding protein (atu3699, agr_l_2275) from agrobacterium tumefaciens str. c58 at 1.60 A resolution
Class: translation
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, translation
Deposited on 2004-05-24, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.154
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein atu3699
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: ATU3699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkia_
  • Chain 'B':
    Compound: hypothetical protein atu3699
    Species: Agrobacterium tumefaciens [TaxId:176299]
    Gene: ATU3699
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkib_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkiA (A:)
    mgsdkihhhhhhmtensrktatelfefldglgishttkqhepvftvaesqslrdlipggh
    tknlfvkdkkdqyfvltveenavvdlksvhktigaasrvsfgrpekmleylgvvpgsvtv
    fgaindtarqvtfvldsdllenelvnghplsndqtttiaskdlirfleatghaplvlkvs
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkiA (A:)
    srktatelfefldglgishttkqhepvftvaesqslrdlipgghtknlfvkdkkdqyfvl
    tveenavvdlksvhktigaasrvsfgrpekmleylgvvpgsvtvfgaindtarqvtfvld
    sdllenelvnghplsndqtttiaskdlirfleatghaplvlkvse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkiB (B:)
    mgsdkihhhhhhmtensrktatelfefldglgishttkqhepvftvaesqslrdlipggh
    tknlfvkdkkdqyfvltveenavvdlksvhktigaasrvsfgrpekmleylgvvpgsvtv
    fgaindtarqvtfvldsdllenelvnghplsndqtttiaskdlirfleatghaplvlkvs
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkiB (B:)
    nsrktatelfefldglgishttkqhepvftvaesqslrdlipgghtknlfvkdkkdqyfv
    ltveenavvdlksvhktigaasrvsfgrpekmleylgvvpgsvtvfgaindtarqvtfvl
    dsdllenelvnghplsndqtttiaskdlirfleatghaplvlkvse