PDB entry 1vkh

View 1vkh on RCSB PDB site
Description: crystal structure of a putative serine hydrolase (ydr428c) from saccharomyces cerevisiae at 1.85 a resolution
Class: hydrolase
Keywords: putative serine hydrolase, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, hydrolase
Deposited on 2004-05-20, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.145
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative serine hydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ydr428c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04066 (12-272)
      • leader sequence (10-11)
      • modified residue (12)
      • modified residue (71)
      • modified residue (117)
      • modified residue (141)
      • modified residue (148)
      • see remark 999 (172)
      • modified residue (191)
      • modified residue (200)
      • modified residue (214)
    Domains in SCOPe 2.07: d1vkha1, d1vkha2
  • Chain 'B':
    Compound: putative serine hydrolase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ydr428c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04066 (Start-272)
      • modified residue (71)
      • modified residue (117)
      • modified residue (141)
      • modified residue (148)
      • see remark 999 (172)
      • modified residue (191)
      • modified residue (200)
      • modified residue (214)
    Domains in SCOPe 2.07: d1vkhb_
  • Heterogens: CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkhA (A:)
    mgsdkihhhhhhmsntvraispditlfnktltfqeisqntreaviyihggawndpentpn
    dfnqlantiksmdtestvcqysieyrlspeitnprnlydavsnitrlvkekgltninmvg
    hsvgatfiwqilaalkdpqekmseaqlqmlgllqivkrvflldgiyslkellieypeydc
    ftrlafpdgiqmyeeepsrvmpyvkkalsrfsidmhlvhsysdelltlrqtnclisclqd
    yqlsfklylddlglhndvykngkvakyifdnic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkhA (A:)
    hhmtvraispditlfnktltfqeisqntreaviyihggawndpentpndfnqlantiksm
    dtestvcqysieyrlspeitnprnlydavsnitrlvkekgltninmvghsvgatfiwqil
    aalkdpqekmseaqlqmlgllqivkrvflldgiyslkellieypeydcftrlafpdgiqm
    yeeepsrvmpyvkkalsrfsidmhlvhsysdelltlrqtnclisclqdyqlsfklylddl
    glhndvykngkvakyifdnic
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkhB (B:)
    mgsdkihhhhhhmsntvraispditlfnktltfqeisqntreaviyihggawndpentpn
    dfnqlantiksmdtestvcqysieyrlspeitnprnlydavsnitrlvkekgltninmvg
    hsvgatfiwqilaalkdpqekmseaqlqmlgllqivkrvflldgiyslkellieypeydc
    ftrlafpdgiqmyeeepsrvmpyvkkalsrfsidmhlvhsysdelltlrqtnclisclqd
    yqlsfklylddlglhndvykngkvakyifdnic
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkhB (B:)
    pditlfnktltfqeisqntreaviyihggawndpentpndfnqlantiksmdtestvcqy
    sieyrlspeitnprnlydavsnitrlvkekgltninmvghsvgatfiwqilaalkdpqek
    mseaqlqmlgllqivkrvflldgiyslkellieypeydcftrlafpdgiqmyeeepsrvm
    pyvkkalsrfsidmhlvhsysdelltlrqtnclisclqdyqlsfklylddlglhndvykn
    gkvakyifdnic