PDB entry 1vke

View 1vke on RCSB PDB site
Description: Crystal structure of carboxymuconolactone decarboxylase family protein possibly involved in antioxidative response (TM1620) from Thermotoga maritima at 1.56 A resolution
Class: lyase
Keywords: TM1620, CARBOXYMUCONOLACTONE DECARBOXYLASE FAMILY PROTEIN POSSIBLY INVOLVED IN ANTIOXIDATIVE RESPONSE, STRUCTURAL GENOMICS, JCSG, PROTEIN STRUCTURE INITIATIVE, PSI, Joint Center for Structural Genomics, LYASE
Deposited on 2004-05-13, released 2004-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: 0.159
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxymuconolactone decarboxylase family protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vkea_
  • Chain 'B':
    Compound: carboxymuconolactone decarboxylase family protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vkeb_
  • Chain 'C':
    Compound: carboxymuconolactone decarboxylase family protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vkec_
  • Chain 'D':
    Compound: carboxymuconolactone decarboxylase family protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vked_
  • Chain 'E':
    Compound: carboxymuconolactone decarboxylase family protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vkee_
  • Chain 'F':
    Compound: carboxymuconolactone decarboxylase family protein
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: TM1620
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1vkef_
  • Heterogens: UNL, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkeA (A:)
    mgsdkihhhhhhmeykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkel
    mglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviphlrravgflee
    lremekngetisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkeA (A:)
    kkfvearrelnekvsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddcir
    yhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetisl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkeB (B:)
    mgsdkihhhhhhmeykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkel
    mglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviphlrravgflee
    lremekngetisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkeB (B:)
    gtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasdeei
    fealdialvvggsiviphlrravgfleelremekngetisl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vkeC (C:)
    mgsdkihhhhhhmeykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkel
    mglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviphlrravgflee
    lremekngetisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkeC (C:)
    gtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasdeei
    fealdialvvggsiviphlrravgfleelremekngetis
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vkeD (D:)
    mgsdkihhhhhhmeykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkel
    mglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviphlrravgflee
    lremekngetisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkeD (D:)
    srgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasde
    eifealdialvvggsiviphlrravgfleelremekngeti
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vkeE (E:)
    mgsdkihhhhhhmeykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkel
    mglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviphlrravgflee
    lremekngetisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkeE (E:)
    eykkfvearrelnekvsrgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddc
    iryhlvrcvqegasdeeifealdialvvggsiviphlrravgfleelremekngetisl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vkeF (F:)
    mgsdkihhhhhhmeykkfvearrelnekvlsrgtlntkrffnldsavyrpgkldvktkel
    mglvastvlrcddciryhlvrcvqegasdeeifealdialvvggsiviphlrravgflee
    lremekngetisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkeF (F:)
    rgtlntkrffnldsavyrpgkldvktkelmglvastvlrcddciryhlvrcvqegasdee
    ifealdialvvggsiviphlrravgfleelremekng