PDB entry 1vkd

View 1vkd on RCSB PDB site
Description: crystal structure of a predicted glycosidase (tm1225) from thermotoga maritima msb8 at 2.10 a resolution
Deposited on 2004-05-12, released 2004-05-25
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-25, with a file datestamp of 2004-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.164
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vkda_
  • Chain 'B':
    Domains in SCOP 1.71: d1vkdb_
  • Chain 'C':
    Domains in SCOP 1.71: d1vkdc_
  • Chain 'D':
    Domains in SCOP 1.71: d1vkdd_
  • Chain 'E':
    Domains in SCOP 1.71: d1vkde_
  • Chain 'F':
    Domains in SCOP 1.71: d1vkdf_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkdA (A:)
    mgsdkihhhhhhmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsa
    vvpyngefvgvfridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydpr
    vvkiedtyyitfctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvml
    nrpsdnghtpfgdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwll
    iyhgvtltcngyvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaal
    cdadtgrvaiyygaadthvalafgyideivdfvkrnsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkdA (A:)
    hmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgv
    fridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyit
    fctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpf
    gdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcng
    yvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiy
    ygaadthvalafgyideivdfvkrnsm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkdB (B:)
    mgsdkihhhhhhmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsa
    vvpyngefvgvfridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydpr
    vvkiedtyyitfctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvml
    nrpsdnghtpfgdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwll
    iyhgvtltcngyvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaal
    cdadtgrvaiyygaadthvalafgyideivdfvkrnsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkdB (B:)
    mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
    ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
    ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
    diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
    vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
    gaadthvalafgyideivdfvkrnsm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vkdC (C:)
    mgsdkihhhhhhmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsa
    vvpyngefvgvfridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydpr
    vvkiedtyyitfctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvml
    nrpsdnghtpfgdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwll
    iyhgvtltcngyvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaal
    cdadtgrvaiyygaadthvalafgyideivdfvkrnsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkdC (C:)
    mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
    ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
    ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
    diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
    vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
    gaadthvalafgyideivdfvkrnsm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vkdD (D:)
    mgsdkihhhhhhmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsa
    vvpyngefvgvfridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydpr
    vvkiedtyyitfctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvml
    nrpsdnghtpfgdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwll
    iyhgvtltcngyvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaal
    cdadtgrvaiyygaadthvalafgyideivdfvkrnsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkdD (D:)
    mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
    ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
    ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
    diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
    vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
    gaadthvalafgyideivdfvkrnsm
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vkdE (E:)
    mgsdkihhhhhhmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsa
    vvpyngefvgvfridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydpr
    vvkiedtyyitfctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvml
    nrpsdnghtpfgdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwll
    iyhgvtltcngyvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaal
    cdadtgrvaiyygaadthvalafgyideivdfvkrnsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkdE (E:)
    mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
    ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
    ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
    diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
    vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
    gaadthvalafgyideivdfvkrns
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vkdF (F:)
    mgsdkihhhhhhmkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsa
    vvpyngefvgvfridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydpr
    vvkiedtyyitfctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvml
    nrpsdnghtpfgdiflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwll
    iyhgvtltcngyvysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaal
    cdadtgrvaiyygaadthvalafgyideivdfvkrnsm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkdF (F:)
    mkvftekipnipweerpegytgpvwrysknpiigrnpvpkgarvfnsavvpyngefvgvf
    ridhkntrpflhfgrskdginweiepeeiqwvdvngepfqpsyaydprvvkiedtyyitf
    ctddhgptigvgmtkdfktfvrlpnayvpfnrngvlfprkingkyvmlnrpsdnghtpfg
    diflsespdmihwgnhrfvlgrssynwwenlkigagpypietsegwlliyhgvtltcngy
    vysfgaalldlddpskvlyrsryylltpeeeyetvgfvpnvvfpcaalcdadtgrvaiyy
    gaadthvalafgyideivdfvkrnsm