PDB entry 1vkc

View 1vkc on RCSB PDB site
Description: putative acetyl transferase from pyrococcus furiosus
Deposited on 2004-05-11, released 2004-12-14
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-14, with a file datestamp of 2004-12-14.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.211
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1vkca_
  • Chain 'B':
    Domains in SCOP 1.71: d1vkcb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkcA (A:)
    ahhhhhhgseytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqge
    hkffvalnersellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewa
    kergakkivlrveidnpavkwyeergykaralimekpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkcA (A:)
    eytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalne
    rsellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkiv
    lrveidnpavkwyeergykaralimekpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkcB (B:)
    ahhhhhhgseytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqge
    hkffvalnersellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewa
    kergakkivlrveidnpavkwyeergykaralimekpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkcB (B:)
    eytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalne
    rsellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkiv
    lrveidnpavkwyeergykaralimekpi