PDB entry 1vkc

View 1vkc on RCSB PDB site
Description: Putative acetyl transferase from Pyrococcus furiosus
Class: transferase
Keywords: structural genomics, acetyl transferase, Pyrococcus furiosus, Southeast Collaboratory for Structural Genomics, SECSG, Protein Structure Initiative, PSI, TRANSFERASE
Deposited on 2004-05-11, released 2004-12-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative acetyl transferase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkca_
  • Chain 'B':
    Compound: putative acetyl transferase
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vkcb_
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vkcA (A:)
    ahhhhhhgseytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqge
    hkffvalnersellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewa
    kergakkivlrveidnpavkwyeergykaralimekpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkcA (A:)
    eytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalne
    rsellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkiv
    lrveidnpavkwyeergykaralimekpi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vkcB (B:)
    ahhhhhhgseytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqge
    hkffvalnersellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewa
    kergakkivlrveidnpavkwyeergykaralimekpi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vkcB (B:)
    eytivdgeeyieeikkldreisysfvrfpisyeeyeerheelfesllsqgehkffvalne
    rsellghvwicitldtvdyvkiayiydievvkwarglgigsallrkaeewakergakkiv
    lrveidnpavkwyeergykaralimekpi