PDB entry 1vkb

View 1vkb on RCSB PDB site
Description: Crystal structure of an aig2-like protein (a2ld1, ggact, mgc7867) from mus musculus at 1.90 A resolution
Class: transferase
Keywords: Gamma-glutamyl cyclotransferase-like fold, structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, transferase
Deposited on 2004-05-07, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q923B0 (12-160)
      • leader sequence (10-11)
    Domains in SCOPe 2.08: d1vkba1, d1vkba2
  • Heterogens: FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1vkbA (A:)
mgsdkihhhhhhmahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviageh
nipwllylpgkghcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewegdgdpgd
svqcfvyttatyapewlflpyhesydsegphglrynprenr

    Sequence, based on observed residues (ATOM records): (download) 
    >1vkbA (A:)
hhmahifvygtlkrgqpnhkvmldhshglaafrgrgctvesfplviagehnipwllylpg
kghcvtgeiyevdeqmlrflddfedcpsmyqrtalqvqvlewedpgdsvqcfvyttatya
pewlflpyhesydsegphglrynprenr