PDB entry 1vk9

View 1vk9 on RCSB PDB site
Description: CRYSTAL STRUCTURE OF A DUF1893 family protein (TM1506) FROM THERMOTOGA MARITIMA AT 2.70 A RESOLUTION
Class: unknown function
Keywords: structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, unknown function
Deposited on 2004-05-06, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein TM1506
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1506
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1J4 (12-End)
      • leader sequence (1-11)
      • see remark 999 (12)
      • modified residue (69)
      • modified residue (81)
      • modified residue (99)
      • modified residue (123)
      • modified residue (133)
    Domains in SCOPe 2.07: d1vk9a1, d1vk9a2
  • Heterogens: ZN, UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk9A (A:)
    mgsdkihhhhhhveknllrsalkifekkdlsllaysgrsifeskdsglkpvvelfkrfdn
    legslvidkmvgkaaasfllkmkpdhihakviskpalklmneygqsfsydekipfvlgkd
    gksmcpfeklvlemddpeeiirivlskftsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk9A (A:)
    gsdkihhhhhhveknllrsalkifekkdlsllaysgrsifeskdsglkpvvelfkrfdnl
    egslvidkmvgkaaasfllkmkpdhihakviskpalklmneygqsfsydekipfvlgkdg
    ksmcpfeklvlemddpeeiirivlskf