PDB entry 1vk8

View 1vk8 on RCSB PDB site
Description: crystal structure of a putative thiamine biosynthesis/salvage protein (tm0486) from thermotoga maritima at 1.80 a resolution
Class: biosynthetic protein
Keywords: protein with possible role in cell wall biogenesis, structural genomics, joint center for structural genomics, jcsg, protein structure initiative, psi, biosynthetic protein
Deposited on 2004-05-05, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.144
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TM0486
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0486
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYV6 (Start-105)
      • modified residue (46)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vk8a_
  • Chain 'B':
    Compound: hypothetical protein TM0486
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0486
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYV6 (Start-105)
      • modified residue (46)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vk8b_
  • Chain 'C':
    Compound: hypothetical protein TM0486
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0486
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYV6 (12-105)
      • modified residue (12)
      • modified residue (46)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vk8c_
  • Chain 'D':
    Compound: hypothetical protein TM0486
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM0486
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WYV6 (Start-105)
      • modified residue (46)
      • modified residue (65)
    Domains in SCOPe 2.07: d1vk8d_
  • Heterogens: UNL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk8A (A:)
    mgsdkihhhhhhmpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttveg
    efeeimdrvkelaryleqfakrfvlqldidykaggitieekvskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk8A (A:)
    pkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkela
    ryleqfakrfvlqldidykaggitieekvskyr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vk8B (B:)
    mgsdkihhhhhhmpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttveg
    efeeimdrvkelaryleqfakrfvlqldidykaggitieekvskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk8B (B:)
    pkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkela
    ryleqfakrfvlqldidykaggitieekvskyr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vk8C (C:)
    mgsdkihhhhhhmpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttveg
    efeeimdrvkelaryleqfakrfvlqldidykaggitieekvskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk8C (C:)
    mpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkel
    aryleqfakrfvlqldidykaggitieekvskyr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vk8D (D:)
    mgsdkihhhhhhmpkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttveg
    efeeimdrvkelaryleqfakrfvlqldidykaggitieekvskyr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk8D (D:)
    pkvtvsikvvpavedgrlhevidraiekisswgmkyevgpsnttvegefeeimdrvkela
    ryleqfakrfvlqldidykaggitieekvskyr