PDB entry 1vk6

View 1vk6 on RCSB PDB site
Description: crystal structure of nadh pyrophosphatase (1790429) from escherichia coli k12 at 2.20 a resolution
Deposited on 2004-04-30, released 2004-05-11
The last revision prior to the SCOP 1.71 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk6A (A:)
    mgsdkihhhhhhmdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqige
    wqgepvwlvqqqrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemyps
    ktewamlcshcreryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetle
    qavarevmeesgikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyry
    ddlpllpppgtvarrliedtvamcraeye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk6A (A:)
    hmdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqq
    qrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemypsktewamlcshc
    reryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmees
    gikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgt
    varrliedtvamcraey