PDB entry 1vk6

View 1vk6 on RCSB PDB site
Description: Crystal structure of NADH pyrophosphatase (1790429) from Escherichia coli k12 at 2.20 A resolution
Class: hydrolase
Keywords: 1790429, NADH PYROPHOSPHATASE, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2004-04-30, released 2004-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.188
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADH pyrophosphatase
    Species: Escherichia coli [TaxId:83333]
    Gene: NUDC, B3996
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32664 (12-End)
      • leader sequence (11)
      • modified residue (12)
      • see remark 999 (44)
      • modified residue (76)
      • modified residue (116)
      • modified residue (125)
      • modified residue (187)
      • modified residue (212)
      • modified residue (216)
      • modified residue (262)
    Domains in SCOPe 2.07: d1vk6a2, d1vk6a3, d1vk6a4, d1vk6a5
  • Heterogens: ZN, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk6A (A:)
    mgsdkihhhhhhmdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqige
    wqgepvwlvqqqrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemyps
    ktewamlcshcreryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetle
    qavarevmeesgikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyry
    ddlpllpppgtvarrliedtvamcraeye
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk6A (A:)
    hmdriiekldhgwwvvsheqklwlpkgelpygeaanfdlvgqralqigewqgepvwlvqq
    qrrhdmgsvrqvidldvglfqlagrgvqlaefyrshkycgycghemypsktewamlcshc
    reryypqiapciivairrddsillaqhtrhrngvhtvlagfvevgetleqavarevmees
    gikvknlryvtsqpwpfpqslmtafmaeydsgdividpkelleanwyryddlpllpppgt
    varrliedtvamcraey