PDB entry 1vk5

View 1vk5 on RCSB PDB site
Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At3g22680
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG
Deposited on 2004-05-06, released 2004-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: expressed protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At3g22680
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1vk5a_
  • Heterogens: SO4, CPS, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk5A (A:)
    selrpsgdsgssdvdaeisdgfspldtshrdvadegsllrraemyqdymkqvpiptnrgs
    lipftswvglsismkqlygqplhyltnvllqrwdqsrfgtdseeqrldsiihptkaeati
    wlveeihrltpshlhmallwrsdpmyhsfidpifpek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk5A (A:)
    gsllrraemyqdymkqvpiptnrgslipftswvglsismkqlygqplhyltnvllqrwdq
    srfgtdseeqrldsiihptkaeatiwlveeihrltpshlhmallwrsdpmyhsfidpifp
    e