PDB entry 1vk3

View 1vk3 on RCSB PDB site
Description: Crystal structure of Phosphoribosylformylglycinamidine synthase II (TM1246) from Thermotoga maritima at 2.15 A resolution
Class: ligase
Keywords: TM1246, PHOSPHORIBOSYLFORMYLGLYCINAMIDINE SYNTHASE II, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics
Deposited on 2004-04-23, released 2004-05-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-03, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphoribosylformylglycinamidine synthase II
    Species: Thermotoga maritima
    Gene: PURL, TM1246
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X0X3 (Start-614)
      • modified residue (39)
      • modified residue (109)
      • modified residue (122)
      • modified residue (173)
      • modified residue (228)
      • modified residue (236)
      • modified residue (282)
      • modified residue (296)
      • modified residue (334)
      • modified residue (341)
      • modified residue (387)
      • modified residue (403)
      • modified residue (470-471)
      • modified residue (509)
      • modified residue (591)
    Domains in SCOP 1.73: d1vk3a1, d1vk3a2, d1vk3a3, d1vk3a4
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk3A (A:)
    mgsdkihhhhhhmklrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpkt
    gfegnagvvnlddyysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifds
    lhmsriidgiiegiadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdska
    srpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemvee
    glvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqermavv
    tspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedivey
    tpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvthsra
    dlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalknace
    fsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkvakpkpskvfavgwndfelere
    kelwrairklseegafilsssqlltrthvetfreyglkievklpevrpahqmvlvfsert
    pvvdvpvkeigtlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk3A (A:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
    yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
    iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifgga
    tgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlga
    ivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaeviee
    pvyrvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmv
    gtdtvvppgfgaavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaep
    laitncvnygdpdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvg
    mlgkvnpqkvakpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthv
    etfreyglkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr