PDB entry 1vk3

View 1vk3 on RCSB PDB site
Description: Crystal structure of Phosphoribosylformylglycinamidine synthase II (TM1246) from Thermotoga maritima at 2.15 A resolution
Deposited on 2004-04-23, released 2004-05-11
The last revision prior to the SCOP 1.69 freeze date was dated 2004-05-11, with a file datestamp of 2004-05-11.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.19
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk3A (A:)
    mgsdkihhhhhhmklrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpkt
    gfegnagvvnlddyysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifds
    lhmsriidgiiegiadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdska
    srpgqvivifggatgrdgihgasfasedltgdkatklsiqvgdpfaekmlieaflemvee
    glvegaqdlgaggvlsatselvakgnlgaivhldrvplrepdmepweilisesqermavv
    tspqkasrileiarkhllfgdvvaevieepvyrvmyrndlvmevpvqllanapeedivey
    tpgkipefkrvefeevnarevfeqydhmvgtdtvvppgfgaavmrikrdggyslvthsra
    dlalqdtywgtliavlesvrktlsvgaeplaitncvnygdpdvdpvglsammtalknace
    fsgvpvasgnaslyntyqgkpipptlvvgmlgkvnpqkvakpkpskvfavgwndfelere
    kelwrairklseegafilsssqlltrthvetfreyglkievklpevrpahqmvlvfsert
    pvvdvpvkeigtlsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk3A (A:)
    klrylnilkeklgreptfvelqafsvmwsehcgyshtkkyirrlpktgfegnagvvnldd
    yysvafkieshnhpsaiepyngaatgvggiirdvlamgarptaifdslhmsriidgiieg
    iadygnsigvptvggelrisslyahnplvnvlaagvvrndmlvdskasrpgqvivifgga
    tgrdgtklsiqvgdpfaekmlieaflemveeglvegaqdlgaggvlsatselvakgnlga
    ivhldrvplrepdmepweilisesqermavvtspqkasrileiarkhllfgdvvaeviee
    pvyrvmyrndlvmevpvqllanapeediveytpgkipefkrvefeevnarevfeqydhmv
    gtdtvvppgfgaavmrikrdggyslvthsradlalqdtywgtliavlesvrktlsvgaep
    laitncvnygdpdvdpvglsammtalknacefsgvpvasgnaslyntyqgkpipptlvvg
    mlgkvnpqkvakpkpskvfavgwndfelerekelwrairklseegafilsssqlltrthv
    etfreyglkievklpevrpahqmvlvfsertpvvdvpvkeigtlsr