PDB entry 1vk1

View 1vk1 on RCSB PDB site
Description: Conserved hypothetical protein from Pyrococcus furiosus Pfu-392566-001
Class: structural genomics, unknown function
Keywords: reductive methylation, dimethyl lysine, Pyrococcus furiosus, conserved hypothetical protein, structural genomics, PSI, Protein Structure Initiative, Southeast Collaboratory for Structural Genomics, SECSG, unknown function
Deposited on 2004-04-13, released 2004-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U3S5 (Start-241)
      • modified residue (26)
      • modified residue (106)
      • modified residue (111)
      • modified residue (132)
      • modified residue (135)
      • modified residue (158)
      • modified residue (171)
      • modified residue (200)
      • modified residue (220)
    Domains in SCOPe 2.07: d1vk1a_
  • Heterogens: PO4, NA, PEG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk1A (A:)
    mgvekvpkydipvkkveyvfieldkmkpheqlvqreledfiesvtgsgifwkpmllakip
    gtdeylivdghhrwaglqklgakrapsvildyfdegvkvytwypafkgdvnkvierlkae
    gleviedekaeekaekgeiafaligeksfaipggleeqkkvskvldemdqakeielvyyg
    lkedakadmekgeidyvfirkaptkeevmelvkrgevfspkttrhvlpfipdkidvkled
    lf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk1A (A:)
    ipvkkveyvfieldkmkpheqlvqreledfiesvtgsgifwkpmllakipgtdeylivdg
    hhrwaglqklgakrapsvildyfdegvkvytwypafkgdvnkvierlkaegleviedeka
    eekaekgeiafaligeksfaipggleeqkkvskvldemdqakeielvyyglkedakadme
    kgeidyvfirkaptkeevmelvkrgevfspkttrhvlpfipdkidvkledlf