PDB entry 1vk0

View 1vk0 on RCSB PDB site
Description: x-ray structure of gene product from arabidopsis thaliana at5g06450
Deposited on 2004-04-12, released 2004-04-27
The last revision prior to the SCOP 1.67 freeze date was dated 2004-04-27, with a file datestamp of 2004-04-27.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1vk0a_
  • Chain 'B':
    Domains in SCOP 1.67: d1vk0b_
  • Chain 'C':
    Domains in SCOP 1.67: d1vk0c_
  • Chain 'D':
    Domains in SCOP 1.67: d1vk0d_
  • Chain 'E':
    Domains in SCOP 1.67: d1vk0e_
  • Chain 'F':
    Domains in SCOP 1.67: d1vk0f_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk0A (A:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0A (A:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vk0B (B:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0B (B:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vk0C (C:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0C (C:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vk0D (D:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0D (D:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vk0E (E:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0E (E:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vk0F (F:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0F (F:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde