PDB entry 1vk0

View 1vk0 on RCSB PDB site
Description: X-ray Structure of Gene Product from Arabidopsis Thaliana At5g06450
Class: structural genomics, unknown function
Keywords: Protein, homohexamer, Arabidopsis thaliana, At5g06450, Structural Genomics, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, unknown function
Deposited on 2004-04-12, released 2004-04-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • cloning artifact (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d1vk0a1, d1vk0a2
  • Chain 'B':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • cloning artifact (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d1vk0b1, d1vk0b2
  • Chain 'C':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • cloning artifact (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d1vk0c1, d1vk0c2
  • Chain 'D':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • cloning artifact (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d1vk0d1, d1vk0d2
  • Chain 'E':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • cloning artifact (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d1vk0e1, d1vk0e2
  • Chain 'F':
    Compound: hypothetical protein
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At5g06450
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9FNG3 (1-205)
      • cloning artifact (0)
      • modified residue (10)
    Domains in SCOPe 2.07: d1vk0f1, d1vk0f2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vk0A (A:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0A (A:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1vk0B (B:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0B (B:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1vk0C (C:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0C (C:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1vk0D (D:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0D (D:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1vk0E (E:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0E (E:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1vk0F (F:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgfp
    etetktktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedl
    dllrenhglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakweka
    gpeeqleaaaiegwlivnvwdqlsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vk0F (F:)
    sasfdgpkfkmtdgsyvqtktidvgsstdispylsliredsilngnravifdvywdvgft
    ktsgwslssvklstrnlclflrlpkpfhdnlkdlyrffaskfvtfvgvqieedldllren
    hglvirnainvgklaaeargtlvleflgtrelahrvlwsdlgqldsieakwekagpeeql
    eaaaiegwlivnvwdqlsde