PDB entry 1vjy

View 1vjy on RCSB PDB site
Description: Crystal Structure of a Naphthyridine Inhibitor of Human TGF-beta Type I Receptor
Class: transferase
Keywords: transferase, protein kinase, Inhibitor Complex
Deposited on 2004-04-07, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tgf-beta receptor type I
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjya_
  • Heterogens: 460, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjyA (A:)
    iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
    gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
    vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidiapnhrvgtkryma
    pevlddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsvee
    mrkvvceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqeg
    ikm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjyA (A:)
    iartivlqesigkgrfgevwrgkwrgeevavkifssreerswfreaeiyqtvmlrhenil
    gfiaadnkdngtwtqlwlvsdyhehgslfdylnrytvtvegmiklalstasglahlhmei
    vgtqgkpaiahrdlksknilvkkngtcciadlglavrhdsatdtidirvgtkrymapevl
    ddsinmkhfesfkradiyamglvfweiarrcsiggihedyqlpyydlvpsdpsveemrkv
    vceqklrpnipnrwqscealrvmakimrecwyangaarltalrikktlsqlsqqegikm