PDB entry 1vjx

View 1vjx on RCSB PDB site
Description: Crystal structure of a putative ferritin-like diiron-carboxylate protein (tm1526) from thermotoga maritima at 2.30 A resolution
Class: unknown function
Keywords: Structural genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2004-04-01, released 2004-04-13
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.22
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative ferritin-like diiron-carboxylate protein TM1526
    Species: Thermotoga maritima [TaxId:2336]
    Gene: TM1526
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9X1L2 (12-156)
      • cloning artifact (8-11)
      • modified residue (12)
      • modified residue (64)
      • modified residue (151)
    Domains in SCOPe 2.01: d1vjxa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjxA (A:)
    mgsdkihhhhhhmkvsdiltvairleeegerfyrelsehfngeikktfleladqerihae
    ifrkmsdqenwdevdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyy
    elkdglvnsdaqktvkkiidqekehlrkllemkrest
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjxA (A:)
    hhhhmkvsdiltvairleeegerfyrelsehfngeikktfleladqerihaeifrkmsdq
    enwdevdsylagyafyevfpdtseilrrkdltlkevldiaisvekdsiilyyelkdglvn
    sdaqktvkkiidqekehlrkllemkrest