PDB entry 1vjw

View 1vjw on RCSB PDB site
Description: structure of oxidoreductase (nadp+(a),ferredoxin(a))
Class: oxidoreductase
Keywords: thermostable, electron transport, iron-sulfur, 4fe-4s, oxidoreductase
Deposited on 1996-10-09, released 1996-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-14.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.159
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin(a)
    Species: Thermotoga maritima [TaxId:2336]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1vjwa_
  • Heterogens: SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjwA (A:)
    mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisvee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjwA (A:)
    mkvrvdadacigcgvcenlcpdvfqlgddgkakvlqpetdlpcakdaadscptgaisve