PDB entry 1vjv

View 1vjv on RCSB PDB site
Description: Crystal structure of Ubiquitin carboxyl-terminal hydrolase 6 (yfr010w) from Saccharomyces cerevisiae at 1.74 A resolution
Class: hydrolase
Keywords: yfr010w, UBIQUITIN CARBOXYL-TERMINAL HYDROLASE 6, STRUCTURAL GENOMICS, JCSG, PSI, Protein Structure Initiative, Joint Center for Structural Genomics, HYDROLASE
Deposited on 2004-03-29, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin carboxyl-terminal hydrolase 6
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: UBP6, YFR010W
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43593 (Start-414)
      • modified residue (29)
      • modified residue (51)
      • modified residue (79)
      • see remark 999 (97)
      • modified residue (136)
      • modified residue (187)
      • modified residue (259)
      • modified residue (303)
      • modified residue (408)
    Domains in SCOPe 2.07: d1vjva_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1vjvA (A:)
    mgsdkihhhhhhpeqqvqqfaqlpvgfknmgntcylnatlqalyrvndlrdmilnynpsq
    gvsnsgaqdeeihkqiviemkrcfenlqnksfksvlpvvllntlrkcypqfaerdsqggf
    ykqqdaeelftqlfhsmsivfgdkfsedfriqfkttikdtandnditvkenesdsklqch
    isgttnfmrnglleglnekiekrsdltgansiysvekkisrlpkfltvqyvrffwkrstn
    kkskilrkvvfpfqldvadmltpeyaaekvkvrdelrkvekeknekereikrrkfdpsss
    envmtpreqyetqvalnesekdqwleeykkhfppnlekgenpscvynligvithqganse
    sghyqafirdeldenkwykfnddkvsvvekekieslagggesdsalilmykgfgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1vjvA (A:)
    qfaqlpvgfknmgntcylnatlqalyrvndlrdmilnynpsqgvsnsgaqdeeihkqivi
    emkrcfenlqnkfksvlpvvllntlrkcypqfaerdfykqqdaeelftqlfhsmsivfgd
    kfsedfriqfkttikdtandnditvkenesdsklqchisgttnfmrnglleglnekansi
    ysvekkisrlpkfltvqyvrffwkrstnkkskilrkvvfpfqldvadmltpeyaaekvkv
    rdelrkvekeknekvmtpreqyetqvalnesekdqwleeykkhfppnlekgenpscvynl
    igvithqgansesghyqafirdeldenkwykfnddkvsvvekekieslagggesdsalil
    mykgfgl